- HDAC5 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83436
- 0.1 ml (also 25ul)
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: THPEETEEEL TEQQEVLLGE GALTMPREGS TESESTQEDL EEEDEEDDGE EEEDCIQVKD EEGESGAEEG PDLEEPGAGY KKLFSDAQP
- Unconjugated
- HDAC5
- HD5, NY-CO-9
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- histone deacetylase 5
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, Epigenetics
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
Specifications/Features
Available conjugates: Unconjugated